PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00113417001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 237aa    MW: 25430.6 Da    PI: 8.7316
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00113417001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.21.6e-39201191100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdP+yG++g i++lq+++++l
  GSBRNA2T00113417001  20 PCAACKLLRRRCAEECPFSPYFSPHEPHKFAAVHKVFGASNVSKMLLEVGESQRGDAANSLVYEANLRLRDPIYGCMGAISALQHHIQSL 109
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          ++el ++++e
  GSBRNA2T00113417001 110 QSELTTVRTE 119
                          ****999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.18919120IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-4020117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGIRRHVAVP PGTTLNTVTP CAACKLLRRR CAEECPFSPY FSPHEPHKFA AVHKVFGASN  60
VSKMLLEVGE SQRGDAANSL VYEANLRLRD PIYGCMGAIS ALQHHIQSLQ SELTTVRTEI  120
LRHKYREAAT ITSLQNNNNN NFNNTTTSVS DHASLAASIL LPPPPPPPPP PRPPRLFSSQ  180
PAPPPTPPAS LPSPSMVVSS SSSNSSATNS IYNHPPSSTA GYSNSLSSDN NVHYFD*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00113417001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013634930.11e-171PREDICTED: LOB domain-containing protein 13
SwissprotQ9AT611e-112LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0D3BTJ71e-171A0A0D3BTJ7_BRAOL; Uncharacterized protein
STRINGBra018320.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.11e-107LOB domain-containing protein 13